General Information

  • ID:  hor007157
  • Uniprot ID:  Q2KI78
  • Protein name:  Norrin
  • Gene name:  LHB
  • Organism:  Bos taurus
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine)
  • GO MF:  NA
  • GO BP:  GO:0005109 frizzled binding; GO:0042803 protein homodimerization activity; GO:0005125 cytokine activity
  • GO CC:  GO:0048678 response to axon injury; GO:0061304 retinal blood vessel morphogenesis; GO:0010842 retina layer formation; GO:0001525 angiogenesis; GO:0001508 action potential; GO:0016567 protein ubiquitination; GO:0031290 retinal ganglion cell axon guidance; GO:0001974 blood vessel remodeling; GO:0001890 placenta development; GO:0071456 cellular response to hypoxia; GO:0003406 retinal pigment epithelium development; GO:0060221 retinal rod cell differentiation; GO:1990963 establishment of blood-retinal barrier; GO:0035640 exploration behavior; GO:0070086 ubiquitin-dependent endocytosis; GO:0007179 transforming growth factor beta receptor signaling pathway; GO:0006366 transcription by RNA polymerase II; GO:0007224 smoothened signaling pathway; GO:0035426 extracellular matrix-cell signaling; GO:0006749 glutathione metabolic process; GO:0006544 glycine metabolic process; GO:0006954 inflammatory response; GO:0002088 lens development in camera-type eye; GO:0060070 canonical Wnt signaling pathway

Sequence Information

  • Sequence:  TESSFMMDSDPQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECSS
  • Length:  108
  • Propeptide:  MRNHVLAASFSMLSLLALMGDTDSKTESSFMMDSDPQRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECSS
  • Signal peptide:  MAFHSLLLLCLAGLAFVSETAA
  • Modification:  T24 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA